SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013467 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013467
Domain Number 1 Region: 305-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 360-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000743
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013467
Domain Number - Region: 263-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0107
Family Classic zinc finger, C2H2 0.075
Further Details:      
 
Domain Number - Region: 33-94
Classification Level Classification E-value
Superfamily PE/PPE dimer-like 0.0366
Family PE 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013467   Gene: ENSDORG00000014318   Transcript: ENSDORT00000014318
Sequence length 464
Comment pep:novel scaffold:dipOrd1:scaffold_10962:13957:17450:1 gene:ENSDORG00000014318 transcript:ENSDORT00000014318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSPHAAAAAAAAAAFKLSP
AAAHDLSSGQSSAFTPQGSYANALSHHHHHHHHHHASVPTYSGSASAAFNSTRDFLXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLHEQGAGHPSPTGHVDNNQ
VHLGLRGELFGRADPYRPVASPRTDPYTAGAQFPNYSPMNMNMGMNVAAHHGPGAFFRYM
RQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECP
REGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFE
GCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPAASS
GYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV
Download sequence
Identical sequences ENSDORP00000013467 ENSDORP00000013467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]