SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013583 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000013583
Domain Number - Region: 53-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00393
Family HkH motif-containing C2H2 finger 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013583   Gene: ENSDORG00000014445   Transcript: ENSDORT00000014445
Sequence length 422
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1392:47215:51498:1 gene:ENSDORG00000014445 transcript:ENSDORT00000014445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLAXXXXXXXXXXXXXXXXXXXXECKLCT
LHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTK
QRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAF
KVPSREIDKAEGKFWTHWNKETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGL
PPRPPLPEALPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHAPTSGV
HPAAPGVHPPAPGVHPSAPGVHPAASVVHPPTSGVHPPAPVVHPPAPGVHPPAPGVHPPA
PGVHPPPSAGVHPQAPGVHPAPAVHPQAPGVHPQAPGIHPQAPGVHSTLGFTLSWSTPSA
SW
Download sequence
Identical sequences ENSDORP00000013583 ENSDORP00000013583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]