SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013622 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013622
Domain Number 1 Region: 323-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 284-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000112
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 420-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000143
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 478-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000005
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 5 Region: 379-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000164
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013622   Gene: ENSDORG00000014487   Transcript: ENSDORT00000014486
Sequence length 591
Comment pep:novel scaffold:dipOrd1:scaffold_26035:3700:10666:1 gene:ENSDORG00000014487 transcript:ENSDORT00000014486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERFKDSGTQTDAVVVLSLAQAVLGLVSENELFGATISAEAFYPDLGPELSGTTTGDPGP
PGPDIYQLACNGRALEEPVEEEVLEVEAAFEKHTRRKTRPPVRLVPKVKFEKVEEDEEQE
VYEVSVPGVDKDGGAAAEAVAEAGEALVQSSAVRMMDLSAFGRKLRPLRPTPRTPRPELD
AAPFEPPFPEPQPGAALPGPEALPAECGFPPAHLAPLGDPEVPALASPEPGKPESGFVWQ
EAGEFEADAAGSTAERHKKAQLDRLDINVQIDDSYLVEAGDRQKRWQCRMCEKSYTSKYN
LVTHILGHNGIKPHSCPHCSKLFKQPSHLQTHLLTHQGTRPHKCQVCHKAFTQTSHLKRH
MLLHSEVKPYSCHFCGRGFAYPSELKAHEVKHESGRCHVCVECGLDFSTLTQLKRHLGSH
QGPTLYQCLECDKSFHYRSQLQNHVLKHQNVRPFVCTECGMEFSQVHHLKQHSLTHKVCG
KSFNRMYNLLGHMHLHAGSKPFKCPYCSSKFNLKGNLSRHMKVKHGVMDLGLDSQDPMME
LAGPDPSELDSQQEMEDFEDGGYTFTGVDGGAEASALTEQAMKEMAYYNVL
Download sequence
Identical sequences ENSDORP00000013622 ENSDORP00000013622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]