SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013626 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013626
Domain Number 1 Region: 105-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-21
Family Classic zinc finger, C2H2 0.00034
Further Details:      
 
Domain Number 2 Region: 69-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-16
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 3 Region: 632-699
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000984
Family Homeodomain 0.0029
Further Details:      
 
Domain Number 4 Region: 443-503
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000188
Family Homeodomain 0.0031
Further Details:      
 
Domain Number 5 Region: 531-583
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000321
Family Homeodomain 0.0008
Further Details:      
 
Domain Number 6 Region: 275-326
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000599
Family Homeodomain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013626   Gene: ENSDORG00000014490   Transcript: ENSDORT00000014490
Sequence length 831
Comment pep:novel scaffold:dipOrd1:scaffold_27383:3466:5961:1 gene:ENSDORG00000014490 transcript:ENSDORT00000014490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTTPCMVRTSQVVEQDVAEEADRAKEKGMGIPPSDGAKDRWAADPENSSKESEL
IEVKPTGENPSKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTK
KYDSLSEHNSKFHPGEANFKLKLIKRNNQTVLEQSIEATNHVGSITTGGPGSGDSDPGIP
VSKTPIMKAGKPKADTKKAPKKPEEAIPENHMEGTARLVTDTAEILSRLGGVELLQDSLG
HVMPSVQLPPNINLVPKVPVPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASK
HPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPAQLAPTKVSQP
ILQTALPCQILGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGHKRPLVTPQAAPEPKR
PHIAQVPEPPPPKVANTPLPPASDRKKTKLQIAHLKASFLQSQFPDDAEVYRLIEVTGLA
RSEIKKWFSDHRYRCQRGIVHITSESLAKDQMAISTSRHGRTYHAYPDFAPQKFKEKTQG
QVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSSK
KGPDVVTPNGALSRLDQLSGAQLSSSLPSPSPAITQSQEQVHLLRSTFARTQWPTPQEYD
QLAAKTGLVRTEIVRWFKENRCLLKTGALKWMDHYPQPHSSDESGYEAVTRKVTKPISES
PKNGSEVIPQYHRDPKMLCEENLEKSVPRRKAASEQAKDSLAAKPSEATSNGSEGSDENE
ESGIVDFVEVTVGEEDATSDKSDSWSQAAGDGTAEGADSDSDGAPAEASQA
Download sequence
Identical sequences A0A1S3GFR5
XP_012887708.1.60039 ENSDORP00000013626 ENSDORP00000013626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]