SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013687 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013687
Domain Number 1 Region: 716-1097
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.84e-116
Family Ankyrin repeat 0.00000285
Further Details:      
 
Domain Number 2 Region: 493-716
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-57
Family Ankyrin repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013687   Gene: ENSDORG00000014556   Transcript: ENSDORT00000014554
Sequence length 1425
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3968:7608:40400:-1 gene:ENSDORG00000014556 transcript:ENSDORT00000014554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNPWEEKSCKMAQTSLLQGKQFYCREVFHKLQHCLQEKTNGCNSTASTPSLVMNSGNNA
GAVSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVLLPLLGMK
PPQQSLYLLVDSVDEGWNIAEGEQTSSSLSGTVAELLAGHHDFFPPWLLLLCSARKQSKA
VTKMFTGFRKISLDDLRKAYIVKDVQQYILHRLDQEEALRQHLTKETAEMLNQLHIKSSG
CFLYLERVLDGVVENFIMLREIRDIPGTLNGLYLWLCQRLFVRKQFAKVQPILNVILAAC
RPLTVTELYHAVWTKNMSLTLEDFQRKLDVLSKLLVDGLGNTKILFHYSFAEWLLDVKHC
TQKYLCNAAEGHRMLAMSYTCRAKNLTPLEAQEFALHLIHSNLQLEPAELALWMIWNGTP
VGDSLSTLIPKEQEVLQLLVKAGAHVNSEDERASCIVRQALEREDSIRTLLDNGASVNQC
DSSGRTLLANAAYSGNLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCMGRGA
NINHTDQDGWTVLRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIVLN
LLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAKVDHEDVDGRTALSVAALCVP
ASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDHNGR
TPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENH
RDDAGWTPLHMAAFEGHRLICEALIEQGARTNETDNDGRIPFILASQEGHYDCVQILLES
KSNVDQRGYDGRNALRVAALEGHRDIVELLLSHGADVDYKDADGRPTLYILALENQLTMA
EYFLENGANVEASDAEGRTALHVSCWQGHVEMVQVLIACHADVNAADNEKRSALQSAAWQ
GHVRVCQLLIEHGAQVDHTCNQGATALCIAAQEGHVDVVQVLLEHAADPNHADQFGRTAM
RVAAKNGHSQIIKLLEKYGASTLNGCSPSPVHTMEQKPPQSNSSRMQSLTMKSSSSGSTG
GGDAQSSLRGGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTTSSTATA
QTVPMDSFHSLSFTEQIQQHSLPRSRSRQSIISPSSTTQSLAHSHTSPCSDFEWSQVQPS
VKSSKPPKGGGTSENASKSGSAGKKANKSSNCSQSKVLEYEMTQFDKRGPVGKCGSSVPL
KQGPVDAQGKIVLPATPQDTGRAPQQLLGGEQKRRNGIMTNPNYLQSNQVFLGRAPVPRT
VQDRGPQDLLEGFPSSETQLSLKQALKLQIEGSDPGFNYKKETPL
Download sequence
Identical sequences ENSDORP00000013687 ENSDORP00000013687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]