SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013690 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013690
Domain Number 1 Region: 36-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000456
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013690   Gene: ENSDORG00000014559   Transcript: ENSDORT00000014557
Sequence length 161
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2226:36017:40958:1 gene:ENSDORG00000014559 transcript:ENSDORT00000014557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPVQPVKRELLRHRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDH
INGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKA
YKKEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY
Download sequence
Identical sequences ENSDORP00000013690 ENSDORP00000013690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]