SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013761 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013761
Domain Number 1 Region: 303-417
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-35
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 2 Region: 147-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-27
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 265-298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013761   Gene: ENSDORG00000014629   Transcript: ENSDORT00000014629
Sequence length 428
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_639:42645:46760:-1 gene:ENSDORG00000014629 transcript:ENSDORT00000014629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNHSDAILYTEVTELSKNEFCNPAFEPEAGPPCLPPAFQQDGRCTIQAPWHGRRPRGLR
PDCHFSCLCILLLTSLLLLLLGLLVAVILAQLQVAPLSGTTGSPWPTQSLATINTVSATT
TTTTSTASPTTTGQQEADTSPSRHATCGGLLPGPSGFFSSPNYPDPYPPNAHCVWQIQVA
KDQAIQLKIEALGIEGVASCLFDRLEIFTEPEGPLLRVCGRVPPPTLNTNASRLRATFVS
DSSVEGXXXXXXXXXXXXXXXSLVQDEFHCDQLVCLLPDSVCDGFANCADGSDETNCSAK
ISGCGGNLTGLQGTFSTPNSLQQYPVQQLCTWHISVPVGHGIELQFHNFSLEEHDECQFD
YVEVYEGHNPGPLSLLGRFCGAEPPRPLISSHQQLAVLFRTAQGTSSRGFSATYRAFNAT
EPCGPREL
Download sequence
Identical sequences ENSDORP00000013761 ENSDORP00000013761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]