SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013807 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013807
Domain Number 1 Region: 276-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000044
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 308-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000926
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013807   Gene: ENSDORG00000014676   Transcript: ENSDORT00000014676
Sequence length 346
Comment pep:novel scaffold:dipOrd1:scaffold_6540:28505:42698:-1 gene:ENSDORG00000014676 transcript:ENSDORT00000014676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMFDPVPVKQEALDPVSVSYPSNYMESIKPNKYGVIYSTPLPDKFFQTPEGLTTHGIQV
EPVDLTVNKRGSPPSAGSSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFPV
PLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHIQQPLMVSLSEEMENSNSS
MQVPVIESYEKPILQKKIKIEPGMEPQRTDYYPPEEMSPPLMNSVSPPQALLQENHPSVI
VQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCWEGCTW
KFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
Download sequence
Identical sequences ENSDORP00000013807 ENSDORP00000013807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]