SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013875 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013875
Domain Number 1 Region: 258-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000069
Family HkH motif-containing C2H2 finger 0.056
Further Details:      
 
Domain Number 2 Region: 179-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000175
Family HkH motif-containing C2H2 finger 0.065
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013875
Domain Number - Region: 92-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00357
Family HkH motif-containing C2H2 finger 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013875   Gene: ENSDORG00000014751   Transcript: ENSDORT00000014750
Sequence length 392
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3991:82610:426301:-1 gene:ENSDORG00000014751 transcript:ENSDORT00000014750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHMMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTTAAVNLFPNFNAMDPIQ
KAVINHTFGVPLPHRRKQXXXXXXXXXXXXXXSQAAAHYKGTKHAKKVKALEAMKSKQKS
VTAKDSAKTTFTSITTNTITTSSDKTDSTTGTSAISKTTSVEIRKSSVMTTEITSKAEKS
PTTASGNSSCPSTEMEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGT
IKAFPWAGVKGKGPVNKENTLQNKHCEICDVHVNSETQLKQHISSRRHKDRAAGKPPKPK
YCPYNKLLKAAHPLGVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVAVNSPFSLRTAPAA
TLFQTSALPPALLRPAPGPIRTAHTPVLFAPY
Download sequence
Identical sequences ENSDORP00000013875 ENSDORP00000013875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]