SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013885 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013885
Domain Number 1 Region: 555-799
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-88
Family Eukaryotic proteases 0.0000968
Further Details:      
 
Domain Number 2 Region: 334-440
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000419
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 73-134
Classification Level Classification E-value
Superfamily SEA domain 0.0000000327
Family SEA domain 0.0076
Further Details:      
 
Domain Number 4 Region: 483-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 448-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013885
Domain Number - Region: 232-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00327
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013885   Gene: ENSDORG00000014761   Transcript: ENSDORT00000014761
Sequence length 800
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1108:96725:125266:-1 gene:ENSDORG00000014761 transcript:ENSDORT00000014761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWAEARQAAGGQGDGGDGEEAEPEGMFRGTKDTKKKARDYLRLAPLWLALAALASAGVI
LWYFLGYKAEVTVSQVYAGSIRVLNRHFSQDLARRESSAFRGESAKAQKMLKELIFSTRL
GAFYNSSSVYSFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXCYRYTYVGRGQALRLKGPDQLASSCLWHLQG
PEDLMLKLRLEWMLAECRXXXXXXXXXXXXXXXXXXXVYGCSRQEPVLEVLASGATMAVV
WKKGLYSYLDPFTLSVQPVAFQACQVNLTLEGRLDLQGVLSTPYFPSYYSPSTHCSWHLT
VPSLDYGLALWFDAYALRRQKYDLPCTQGQWIIQDRRLCGLRTLQPYAERIPVAASTGIT
INFTSQISLTGPGVQVHYSLYNQSDPCPGEFLCSVNGLCVPACDGIKDCPNGLDERNCVC
RATFQCHEDSTCISMSRVCDRQPDCLNSSDEEQCQEGVPCGTFTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRW
VVTAAHCFQEDSMASPALWTVFLGKVRQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVAL
LQLDHPVVRSASVHPVCLPARSHFFEPGLHCWITGWGALREGGPTSNVLQKVDVQLVPQD
LCSEAYRYRVTPRMLCAGYRKGKKDACPGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPN
YFGVYTRITGVIGWIQQVLT
Download sequence
Identical sequences ENSDORP00000013885 ENSDORP00000013885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]