SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013958 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000013958
Domain Number - Region: 495-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.065
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013958   Gene: ENSDORG00000014837   Transcript: ENSDORT00000014837
Sequence length 1194
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2318:25629:81325:-1 gene:ENSDORG00000014837 transcript:ENSDORT00000014837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLHRDVNKTKSRLNVLNGLANNMDDLKINTDITGAKEELLDDSSFISEKDSGVHKSK
DYQTSFQKNNTLTLPEELSKDKSEKALSGAQSTLMIHSGAPVVSSEKFTLPKGAIVNGPV
SHSSLTKTSSMNKGSVSITTGQPVDHPTTESCSTLKVATDLQLSTSQNASQHQVLFLLSD
VAHTKNPTHSIKKLPTSASVGCDIQNSVGNSIKSDSTLINQVEVGEERKDLLVKDGINTL
TGISSGTDEFKSKNDTDWDPQKEFISFLMTNEETVKKAPILSKVSLEKKKRKMXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFMAVTENELEC
HRGIAHGAAVKCPVVNSDVAQRKTQKKTSVKDSVTGSSRKSASYVCKMCPFTTSARNILK
KHMEYLHSSSSVDSFGSPLGLDKRKSDVLEEPIDIDGSKPLVKQQSTTFPKNSALKQDVK
RTFGSSSQSSNFSKLHKRPHRIQKARKSIAQSGVNSCNPNNTPHKTVTIKSSVDQKPKYL
HQATKEKSNAKVNNNYLYRHKYENYRMIKKSGESYPLHFKKEVSPLNSLHLFSSSSNSHN
SFISDPHNSDTKRPESFKDRRRVAVKRVVKGSKKESSVGGEDLDSYPDFLHKMTVVVLQK
LNSAEKKDSYETEDDSSWDNVELGDYTTQAIEDETYSELNQEHVNLFPLHKQKEKSRKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXRRIIPRPFVAQLGSSDDFLSQVLPLEAYRNGLKTEALSVSASEEEGLNFIND
YEETKPELPSGRKNQSLTLIELLKNKRMGEERSSAISPQKIHQTARKRFVQKCVLPLSED
SPLMYQPQKMDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCRFCGLVFRGP
LSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS
Download sequence
Identical sequences ENSDORP00000013958 ENSDORP00000013958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]