SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013970 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013970
Domain Number 1 Region: 383-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000435
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 227-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000505
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013970   Gene: ENSDORG00000014849   Transcript: ENSDORT00000014849
Sequence length 636
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4974:720:33688:1 gene:ENSDORG00000014849 transcript:ENSDORT00000014849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXGRLIDGQVIQLEDGSAAYVQHVPIPKSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVSIDGSESVTGTGMIGENEQEKKMQMLQGHASRVTAKRQSGEKAFRCQYE
GCGKLYTAAHHLKVHERSHTGDRPYQCEHAGCGKAFATXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNHC
GKTYKQISTLAMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVV
STQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XNGTQIAVQLGEQPSLEEAIRIASRIQQGETPGLDD
Download sequence
Identical sequences ENSDORP00000013970 ENSDORP00000013970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]