SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014005 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014005
Domain Number 1 Region: 216-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 257-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000571
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 168-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000389
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014005   Gene: ENSDORG00000014886   Transcript: ENSDORT00000014886
Sequence length 524
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2489:36213:40110:1 gene:ENSDORG00000014886 transcript:ENSDORT00000014886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLDEPLDLKLSITKLRAAREKRERTLGAARQRALHRELGLVDDSPTPGSPGSPTSGFL
LNPKFPEKVDGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPMPTAPDFQPL
RYLDGVPSSFQFFLPLGSGGALHLPTSSFLTPTKDKCLSPELPLPKQLVCRWAKCNQLFE
LLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTC
NKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC
HKRYTDPSSLRKHIKAHGHFVSQEQQELLQLRPPPKPPLPTPDSGPYVSGAQIIIPNPAA
LFGGPSLPGLPLPLPPGPLDLSALACGNGGGVGAGGSMGPGLPGPVLPLNLAKNPLLPSP
FGAGGLGLPVVSLLAGSAGGKAEGEKGRGSVPSRALGMEGRKTPLDRTESSRSRPNPDGL
PLLPGTVLDLSTGVNSAASSPEALTPGWVVIPPGSVLLKPAVVN
Download sequence
Identical sequences A0A1S3ETG6
XP_012867220.1.60039 ENSDORP00000014005 ENSDORP00000014005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]