SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014050 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014050
Domain Number 1 Region: 23-47
Classification Level Classification E-value
Superfamily RING/U-box 0.000000951
Family RING finger domain, C3HC4 0.034
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014050
Domain Number - Region: 137-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0262
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014050   Gene: ENSDORG00000014937   Transcript: ENSDORT00000014932
Sequence length 228
Comment pep:novel scaffold:dipOrd1:scaffold_15300:10347:21746:1 gene:ENSDORG00000014937 transcript:ENSDORT00000014932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQQQCREGVTPLARPAAEADPLGRFTCPVCLEVYDKPVQVPCGHVXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRAVELERQIESTETSCHGCRKNFFLSKIRAHVATCSKYQNYIMEG
VKATTKDASLQPRSVPNRYTFPCPYCPEKNFDQEGLVEHCRLSHSTDTKPVVCPICASMP
WGDPSYRSANFIQHIQRRHQFSYDTFVDYDVDEEDMMNQVLQRSLVDQ
Download sequence
Identical sequences ENSDORP00000014050 ENSDORP00000014050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]