SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014071 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014071
Domain Number 1 Region: 1461-1501
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000263
Family Ankyrin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014071   Gene: ENSDORG00000014953   Transcript: ENSDORT00000014953
Sequence length 1679
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_791:7713:48957:1 gene:ENSDORG00000014953 transcript:ENSDORT00000014953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAPLSDEESTTGDCQHFGSQEFCVGGSFSKVELTAVGSGSNARGADSDGSATEKLGHKSE
EQPDDLQSKMDYAGNTAEAEGLLVPLSSPGDGLKLPTPDSPEACNSRADCSWTPLGTQMS
KQVDCSAAGVKALDSRHGVGDKNTFILATLGTGVPVDGSLPLVTTNFSSLPAPICPPAPG
SASVPPSVPDPFQVPLSVPAPVPHSGLVPVQVATSVSAPSPPLAPVPALAQAPAAPSVPT
LISDSSPLSVSASVLVPVPASAPPSVAVPLSAPAPTPLSVPVSAPPLALIQASGTPSAPT
LVLAPVPTPVLAPMPASTPPAAPAPPSVPMPTPTPSSGPPSTPTLIPAFAPTPVPAPTPA
PIFTPAPTPMPAATPTAIPTSAPIPASFSLSRVCFPTAQAPAMQKVPLSFQPGTVLTPNQ
PLVYIPPPSCGQPLSVATLPTTLGVSSTLTLPVLPSYLQDRCLPGVLASPELRSYPYAFS
VARPLTSDSKLVSLEVNRLPCTSPSSSSTTQPTPDGVPGPLADTSLTTASAKVLPTAQPL
LPAPGGSSVPPHPTKMPGGAEQQTEGSSITFSPLKSPPQLEREMASPPECSEMPLDLSSK
SNRQKLPLPNQRKTPPMPVLTPVHTSSKALLSTVLSRSQRTTQAAGSNVTSCLGSTSSPF
VIFPEIVRNGDPSTWVKNSTALISTIPGTYVGVANPVPASLLLNKEPNLGLTRDPRHLPK
QEPISIIDQGEPKSTGAACGKKGTQTGAEGQPSTAKTRYTPTRIAPGLPGCQTKELSLWK
PTGQANIYPRCSVNGKPTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGMSIRPEFSG
VPSLGPSEAVHGLPEGQSRPGGPFSPEQDTVTKNKTCRIAAKPYEEQVNPVLLTLSPQTG
TLALSVPPSSGDIRVDQEPEESDSHLCSDSTLKMESPQAACGLKLAGDTKPKNQVLATYM
SHELVLATPQNLRKMSELPLLPHDSHPKELILDVVPSSKRGSSTELSQLGSQVDLGRVKM
EKVDGDVVFNLASCFRADGLPVAPPRGQAEVRAKAGQPRVKRESVGVFTCKNKWQPDEVT
ESLPPKKMKCGKEKEAEEQQLPPPPQVKPIVRSSLGSKCRKLPSDPQEPTKKSPRGASDS
GKEHNGVRGKHKHRKPTNSESQSPGKCTDGHEEGSLEKKAKSSFRDFIPVVLSTRTRSQS
GSICSSFAGMADSDMGSQEVFPTEEEEEVAPTPAKRRKVRKTQRDTQYRSHHAQDKTLLS
QGRRHLWRAREMPWRTEAARQLWDTNEEEEEDDEEGLVKRKKRRRQKSRKYQTGEYLTEQ
EEEQRRKGRADLKARKQKTSSPSSEHCLRNRNLLLSSKAQGISDSPNGFLPNNLEEPACL
ENSEKPSGKRKCKTKHMVNVSEEIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXPVHDAVVNDNLETIWLLLSYGADPTLATYSGQTAMKLAS
SDTMKRFLRXXXXXXXXXXXXXXXXXXXXXXXXXXXKKDGFACDLLNNPPGSSEQGEEVE
EDDFMFELSDKPLLPCYNLQVSVSRGPCNWFLFTDVLKRLKLSSRIFQARFPHLEITTLP
KAEFHRQVASSQLLTPAERPGGLEDRSPPGSSETVELVRYEPELLRLLGSEVEFQSWNS
Download sequence
Identical sequences ENSDORP00000014071 ENSDORP00000014071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]