SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014140 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014140
Domain Number 1 Region: 284-390
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000095
Family Canonical RBD 0.0064
Further Details:      
 
Domain Number 2 Region: 147-212
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000271
Family Canonical RBD 0.012
Further Details:      
 
Domain Number 3 Region: 213-241
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000012
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014140
Domain Number - Region: 747-803
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00226
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014140   Gene: ENSDORG00000015022   Transcript: ENSDORT00000015022
Sequence length 929
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5883:288:15648:1 gene:ENSDORG00000015022 transcript:ENSDORT00000015022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYERRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXIRGQLQSHGVQAREVRLMRNKSSQSRGFAFVEFSHL
QDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPKS
EAEQKLPLGTRLDQQALPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDT
IILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQ
ILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRINAASVASTAIAAAQWAISQASQGG
EGGWATTEEPPVDYSYYQQDEGYGGSQGTDSSLYAHGYLKGTKGPGMTGSKGDPAGTGPE
ASLEAGADSVSLQAFSRGQPGAAPGLYQQSAEAGSSQGTAANSQSYTIISPAVLKSELQS
PTHPSSALPPATSPNAPDSYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQ
SQQYLYWDGERRTYIPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWARS
LNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHASMDLPKLASDDR
PSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQLS
GLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGGM
AAASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGA
RGSSYGVTSTESYKETLHKTMVTRFNETQ
Download sequence
Identical sequences ENSDORP00000014140 ENSDORP00000014140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]