SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014163 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014163
Domain Number 1 Region: 119-181
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000361
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014163   Gene: ENSDORG00000015046   Transcript: ENSDORT00000015046
Sequence length 464
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6187:170693:223854:-1 gene:ENSDORG00000015046 transcript:ENSDORT00000015046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPVLRPALLLLLLLLLLLLLLHVPTSRGFPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRC
PTLAMPVNGGFKCVDGAYFNSRCEYYCSPGYTLRGEHRVTCMDNKAWSSSPASCTDIDPP
TIKCPSVKERIAEPNKLTVRVSWDTPEGRDTADGILTXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXMNVDVNVRTAAAFLDQFYEKRRLLIVSTPTARNLLYRMQLE
MLQXXXXXXXXXXXXXXXXXXXXXXXXGRISKMMPPALAMQLRLLLRIPLYSYSMVLVDK
QGTDKERYISLVTPKALFNLIDTLALRKEEMVLQAQMGQSCNNW
Download sequence
Identical sequences ENSDORP00000014163 ENSDORP00000014163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]