SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014195 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014195
Domain Number 1 Region: 582-718
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-24
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 192-252,335-384
Classification Level Classification E-value
Superfamily Histone-fold 9.14e-20
Family Nucleosome core histones 0.0098
Further Details:      
 
Domain Number 3 Region: 918-1025
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000597
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 122-192
Classification Level Classification E-value
Superfamily Histone-fold 0.00000153
Family Nucleosome core histones 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014195   Gene: ENSDORG00000015079   Transcript: ENSDORT00000015079
Sequence length 1108
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2691:78486:212417:1 gene:ENSDORG00000015079 transcript:ENSDORT00000015079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASSPYGGSCWPPLADSM
HSRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELEALLLRSRDPRAGPA
PPGSLPKDALAKLSMLVSRALVRIAKEAQRLSLRFAKCTKYEIQSAMEIVLSWSLAAHCT
AAALAALSLYNMSSAGGDRLGRGKSARCGLTFSVGRVYRWMVDSRVALRIHEHAAIYLTA
CMESLFRDIYSRVVASGLPRSCGGPGSGSGSGSGSGPGPSSGPGAAPAAEKEREAPGGGA
ASGGACSAASSASGGSGCCAPPGPGVAAAVPAAAAANHHHHHHALHEAPKFTVETLEHTV
NNDSEIWGLLQPYQHLICGKNASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDLVSRAMHHLQPLNAKHHGNGTPLHHKQGLYWEPEALYTLCYFMHC
PQMEWENPNVEPSKVNLQVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXADDCFCASRKLDAVAIEAKFKQDLGFRMLNCGRTDLVKQAVSLLGPDG
INTMSEQGMTPLMYACVRGDEAMVQMLLDAGADLNVEVVSTPHKYPSVHPETRHWTALTF
AVLHGHIPVVQLLLDAGAKVEGSVEHGEENYSETPLQLAAAVGNFELVSLLLERGADPLI
GTMYRNGISTTPQGDMNSFSQAAAHGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPWTLHTWLESLRIAFQQ
HRRPLIQCLLKEFKTIQEEEYTEELITQGLPLMFEILKASKNEVISQQLCVIFTHCYGPY
PIPKLTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFTASPRXXXXXXXXX
XXXXXXXXXXXXXXXXXXLVMQYLYYGGPESLLIKNNEIMELLSAAKFFQLEALQRHCEI
ICAKSINTDNCVDIYNHAKFLGVTELSAYCEGYFLKNMMVLIENEAFKQLLYDKNGDGTG
QDVLQDLQRTLAIRIQSIHLSSSKGSVV
Download sequence
Identical sequences ENSDORP00000014195 ENSDORP00000014195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]