SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014197 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014197
Domain Number 1 Region: 582-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000073
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 694-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000836
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014197
Domain Number - Region: 417-540
Classification Level Classification E-value
Superfamily SET domain 0.00119
Family Histone lysine methyltransferases 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014197   Gene: ENSDORG00000015081   Transcript: ENSDORT00000015081
Sequence length 793
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2691:268281:309162:-1 gene:ENSDORG00000015081 transcript:ENSDORT00000015081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEMNSPVGMEQLTSSVSNALPVSGSHLGLAASPTHSAIPAPGLPVAIPNLGPSLSSLPS
ALSLMLPMGIGDRGVMCGLPERNYTLPPPPYPHLESSYFRTILPXXXXXXXXXXXPQYIH
PNSINVDGNTALSIANNPSALDPYQSNGNVGLEPGIVSIDSRSVNTHGAQSLHPSDGHEV
ALDTTITMENVSRVTSPISTDGMAEELTIDGVAGEHSQIPNGSRSHEPLSVDSVSNNLTA
DPVGHGGVLPIHGNGLELPVVMETDHIASRVSGMSDSALSDSIHTVAMSTNSVSVALSTS
HNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVPSSLQMEDSNSNK
ENMATLFTIWCTLCDRAYPSDCPEHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGAEVG
VWTAETIPVRTCFGPLIGQQSHSMEVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNW
MMFVRKARNREEQNLVAYHDGKIYICTSQDIPTENELLFYYSRDYAQQMGVPEHPDVHLC
NCGKECSSYSEFKAHLTSHIHNHLPGQGHSNSHGPGHSKERKWKCSMCPQAFISPSKLHV
HIMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERQIKCPKCDKLFLRTNHLKKHLNSHEGK
RDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSSSAQDEDDDDSEEEDLADAVGSEDCRISS
ALYSAEESLAAHK
Download sequence
Identical sequences ENSDORP00000014197 ENSDORP00000014197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]