SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014237 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014237
Domain Number 1 Region: 27-175,211-282
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-52
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 577-758
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-42
Family Ankyrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 344-521
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-39
Family Ankyrin repeat 0.00046
Further Details:      
 
Domain Number 4 Region: 954-1120
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.48e-34
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014237   Gene: ENSDORG00000015121   Transcript: ENSDORT00000015123
Sequence length 1130
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1550:2614:83060:1 gene:ENSDORG00000015121 transcript:ENSDORT00000015123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACRGDVRVKRLMEKVNSRDTAARKSTPLHAAGFGRKDVVEYLLQNGANVQARDDGGLIPL
HNACSFGHAEVVNLLLQHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNT
DGRTALDLADPSAKAVLTGDYKKDELLESARSGNEKMMALLTPLNVNCHASDGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXDLVPLHNACSYGHYEVTXXXXXHGACVNAMDLW
QFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLAPTPQLKERLSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCAAASPYPKRKQICELLLRKGANINEK
TKEFLTPLHVASEKAHNDVVEVVVKHEAKVNALDNLGQTSLHRAAHCGHLQTCRLLLSYG
CDPNIISLQGFTALQMGNENVQQLLQEGIPLGNSEADRQLLEAAKAGDVETVKKLCTIQS
VNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGADPTKKNRDGNTPLDLVKDGD
TDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAE
YLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKG
RTQLCALLLAHGADPTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVR
SPGATADSLSSGPSSPSSLSAASSLDNLSGSFSELSSVVGSSGPEGASSLERKEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQSTVREHRDGGHAGGIFSRYNILK
IQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFG
AGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMA
HSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG
Download sequence
Identical sequences ENSDORP00000014237 ENSDORP00000014237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]