SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014255 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014255
Domain Number 1 Region: 558-637
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000327
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 652-826
Classification Level Classification E-value
Superfamily RNI-like 0.000000235
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014255
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.042
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014255   Gene: ENSDORG00000015142   Transcript: ENSDORT00000015141
Sequence length 876
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6739:53089:64679:-1 gene:ENSDORG00000015142 transcript:ENSDORT00000015141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAAAAAAA
ASGFPLAPEPAALLAVPGARREVFESTSFQGKEQAAGPSPATPHLLHHHHHHAPLAHFPG
DLVPASLPCEELGEPGLVPAAAARYALREIEIPLGELFARKSVASSACSTPPPESGPGPC
SGPASVSPASPSPADVAYEEGLARLKIRALEKLEVDRRLERLSEEVEQKIAGQVGRLQAE
LERKAAELETARQESARLGREKEELEERASELSRQVDVSVELLASLKQDLVHKEQELSRK
QQEVVQIDQFLKETAAREASAKLRLQQFIEELLERADRAERQLQVISSSCGSTPSTSLGR
GGGGSGPGPGARGPGRMREHHAGPAVPSAYAVSRHGSSPSTGASSRVPAASQSSGCYDSD
SLELPRPEDGAPEDSGPGGLGTRAQAANGGSERSQPPRSSGLRRQAIQNWQRRPRRHSTE
GEEGDVSDVGSRTTESEAEGPSDTPRSGPAMAGPLNSCRLSARTEGGGSGRVRRAERGSP
SRSNEVISPEILKMRAALFCIFTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARV
CSKFLAMLAQWCTQAHSLTLQNLKPRQRGKKESKEEYARSTRGCLEAGLESLLKAAGGNL
LILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGHEVIWALGAGCREIVSLQVA
PLHPCQQPTRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVS
EITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPS
SPEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGGC
Download sequence
Identical sequences ENSDORP00000014255 ENSDORP00000014255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]