SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014286 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014286
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.87e-26
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 34-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-23
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 5 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 193-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 278-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000124
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 362-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000678
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014286   Gene: ENSDORG00000015176   Transcript: ENSDORT00000015176
Sequence length 527
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6313:6643:15846:-1 gene:ENSDORG00000015176 transcript:ENSDORT00000015176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSFSRIRQEVQGKGLCTQREESRLAGIVLEAMALQGLVTFRDVVIVFSQEEWKYLEPAQ
RNLYRNVTLETFSHLVSVGLSISKPDVIFLLEQGREPWIIADDMERLWYPDLEPRCETFP
AKGLLEMGSLNWGAVDSLDYHFLGGWECRGPLEVQQVRKQCCSQQVEPMNENVPAFKHPP
TVTLQQPSETCKKVIKCTECGKAFSRSSHLTQHQKTHTGVKPFECPQCGKTFSRASHLVQ
HQRIHTGQRPYGCTECGKAFSRSSELSLHQRLHTGVKPYGCKECGKSFRQHSQLVLHQRT
HTGEKPYVCEDCGKAFIQSSQLTVHQRIHTGARPYQCKECGKAFRQHSQLSVHQRIHTGE
KPYQCKECGKSFFHSSEVTRHQRIHSGEKPYECQECGKAFRQLSQRSRHQRVHTGDRPHK
CKDCGKAFSRSSYLIQHQRIHTGDKPYKCKECGKAFIRVSQLTHHQRTHTCEKPYACREC
GMAFIRSSQLTEHQRIHPGIKPYECRECGQAFVLGSQLIDHYRIHTG
Download sequence
Identical sequences ENSDORP00000014286 ENSDORP00000014286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]