SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014291 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014291
Domain Number 1 Region: 511-816
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-74
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 119-238
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-31
Family Spermadhesin, CUB domain 0.0000161
Further Details:      
 
Domain Number 3 Region: 284-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-30
Family Spermadhesin, CUB domain 0.0000229
Further Details:      
 
Domain Number 4 Region: 400-470
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000513
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 234-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000998
Family EGF-type module 0.00097
Further Details:      
 
Domain Number 6 Region: 467-533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000284
Family Complement control module/SCR domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014291   Gene: ENSDORG00000015179   Transcript: ENSDORT00000015182
Sequence length 828
Comment pep:novel scaffold:dipOrd1:scaffold_2575:18353:73812:-1 gene:ENSDORG00000015179 transcript:ENSDORT00000015182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSQRELVSRADLPRKETDFVVRSLVEEVREERGKARGEGERGSVAGRGRRDLNGECQPI
PETHRDLRTKIRLCRHTGDQLPDKSDRGDQGQAPRHKQGRKMRWLLFYHALCLSLLKACT
HVVELNDMFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKLYFMHFNLESSYLCEYDYVK
VEAEQVLATFCGRETTDTEQTPGQEVVLSPGFFMSITFRSDFSNEERFTGFDAHYMAVDV
DECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQMTGMITSP
DYPNPYPKSSECLYTIGLEEGFVISLQFEDTFDIEDHPEVPCPYDYIKIKAGPNIWGPFC
GEKAPELINTQSHKVQIMFHSDNSGENQGWRLSYTASGNECPELHPPVHGNIEPLQATYS
FKDQVIVTCDTGYKVLKDYMVLDILQMECLKDGTWSHAMPTCEIIDCGVPAGLEHGLITF
STRNNLTTYNSEIRYSCQQPFYKILQNTTGIYTCSALGTWVNEALGTSLPTCHPECGQPS
RSLPNLVKRIIGGRIAEPGLFPWQALIVVEDTSRIPSDKWFGSGALLSESWILTAAHVLR
SQRRDNTVIPVSKEHITVYLGLYDVRDKSGAVNRSAARVVLYPDFNIQNYNHDIALVQLQ
EPVPLGPHVRPVCLPKSEPEGLIPHMLGLVAGWGISNPNVSVDDVLGSGMRTSTDILQYV
KLPVVPHTECKASYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVILDEVSQHWVA
QGLVSWGGPEECGSKQVYGVYTKVSNYVDWLWEEMNSPQDVRELQVER
Download sequence
Identical sequences ENSDORP00000014291 ENSDORP00000014291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]