SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014308 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014308
Domain Number 1 Region: 697-1144
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.21e-54
Family Hermes transposase-like 0.0075
Further Details:      
 
Domain Number 2 Region: 439-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000988
Family BED zinc finger 0.032
Further Details:      
 
Domain Number 3 Region: 110-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000167
Family BED zinc finger 0.055
Further Details:      
 
Domain Number 4 Region: 280-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000226
Family BED zinc finger 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014308   Gene: ENSDORG00000015202   Transcript: ENSDORT00000015201
Sequence length 1149
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3277:8321:12078:1 gene:ENSDORG00000015202 transcript:ENSDORT00000015201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLREACPPGDGGFISNKGDFKPEEDDDNQNPGGGMGRTDFKSEPEGPRQADRGELADE
VDCACRPPPESEDDCGALFSQYSSTLYSVAMEAVAQSLLSSRHASSRKKSPAWKHFFISP
RDSTKAICTYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTKLLQEDGSLSSGAACPSPSAL
LPAPPTDGGDLGTTLSPNRLVQKMAPKIPSPDRVTEESVSVVSSEEASSDVSVAEKYGRD
EALAGALPHLPPLHGDEAAENMAERSLALPKGSSGSRRRSAVWKHFYLSPLDSSKAVCVH
CMNESRGKNGKDLGTSCLIRHMWRAHRSIALQENGGGASIPPLYPAPPTLLPTLLPPEAD
PSSGVPSLGKLVRGCPSAASSPDRLGEDPGDVSVLSSDELAEASLLSSLEKRPAGPVSPR
QGPGGIFQQNKKVMRRLKSEVWHHFSLAPMDSLKAVCRYCGCVISRGKKGDVGTSCLMRH
LYRRHPEVVGGQKDLLGASLANPPYATLASAERASKRIDLPTAARRNRPVLFPVSSKKTS
KLWNHFGCSADSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLPSPSYFSRTAIPGMYDSVKRIIMSHLKEAESGVVHFTSGIWMSSQTRE
YLTLTAHWVTFAPSARSHCEDHHCSALLDVSQIDCDYSGSGIRRQLQCWWEAWVTSIGLR
VGITVTDNPSIGKTLSEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSTARKLCERVHR
SPRAREKLAELQKEYELPPHPLIQDVPSRWSTSFHMLERLIEQKRAVNEMSVECNFRELI
SCDQWEVMQSVCHALRPFDTASREMSAHVSTLSQVIPMIHILSRKVEMLFGETMGIDTML
KSLKEAMASRLSATLHDPRYVFATLLDPRYKASLFTEEEAEQYRQDLIRELEVLNSTSED
TATSNGCDSGSPSKDCGGEESLWSLVAKVKRRDGREKLPEDMVLAYLEEEVLDHSCDPLT
YWGLKRASWPGLSTLAVRFLGCPPSTVPSEKLFSTPTEAGGCGQPRLLTEHFEKLIFLKV
NLPLIYFQY
Download sequence
Identical sequences ENSDORP00000014308 ENSDORP00000014308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]