SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014344 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014344
Domain Number 1 Region: 84-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 715-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000361
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 327-349,588-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000163
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number 4 Region: 233-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000746
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014344   Gene: ENSDORG00000015237   Transcript: ENSDORT00000015238
Sequence length 1180
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6504:14718:38926:1 gene:ENSDORG00000015237 transcript:ENSDORT00000015238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHAFSDMHLWPAPEEADVPLDEKAHLRMSAQPMGNQMALLANQLGREVDSGLNGRVDLQQ
FLNGQNVGIMSQMSDIEDDARKNRKYPCPLCGKRFRFNSILSLHMRTHTGEKPFKCPYCD
HRAAQKGNLKIHLRTHKLGNLGKGRGRVREENRLLHELEERAILRDKQLKGGLAQPRPDL
KPQPHAPPPAPAACGLAPPGNPSLPPDVAAHPAAPSPKPSCVQDDAAAPAAGFRCTFCKG
KFKKREELERHIRILHKPYKCTLCDFAASQEEELIGHVEKAHITAEAQGPGAHGAGEPAA
HEFRCVCGQVFSQAWFLKHMRHDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKAA
GDPDAPPGPLGAGVTAETHATLYSRYMSCLQGGGFVGPDKASLGGGGEPGQFYAKAEHAL
KDKDVLGKLLSPLSSVAHAAPAGDKHSLLGCLNLVPPLKSSCIERLQAAAKAAEMDPVHS
YQAWQLMARGMAAEHGFLSKEHPLSRNHHEDALAGAGLVFDKEKREYVLLGADGSKQKLP
ADLVHGAKAGNQRDPSNKPDPLDGSRDFLTHGLNQTLDYNNLQGPGNMKEKPTECPDCGR
VFRTYHQVVVHSRVHKRDRKGEDDPLHGGLDERRGSGSDQESQSVSRSTTPGSSNVTEES
GVGGGLSQTGSAQEDSPHPSSPSSSDIGEEAGRPSGVQQPALLRDRSLGSAMKDCPYCGK
TFRTSHHLKVHLRIHTGEKPYKCPHCDYAGTQSASLKYHLERHHRERQNGAGPLPGQAPS
QDPRDEMSNKASLFIRPDILRGTFKGLPGIDFRGGPASQQWTSGMLSSGDSLGPAASMSS
ETPSDTLKGTDLPSKSTHFSEIGRAYQSILSNGVNFQGSLQAFMDSFVLSSLKKKDGKDK
ALSDIPSSMKVHTVEGGEEKGSGKPSQKKSEKSQYEPLDLSVRPDAASLPGSSVTVQDSI
AWHGCLFCAFTTSSMELMALHLQANHLGKAKRKEPATGAAGNCKEQTREASKMATVQSNK
EMSLSSTVGCLEATSEKLSHGQAKETLGDPKSAPWPSHVDPAFTNFPSDFYKQFGMYPSM
VGSGVTSSCSNKNPDGKSHPEDDTPILIPEATNKTTMDDLSDITSSEDMDSFKEEEIETE
PEIINKSLPALGKDSGSDSGDSLMPSGVPQPIQGLGSPLA
Download sequence
Identical sequences ENSDORP00000014344 ENSDORP00000014344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]