SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014346 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014346
Domain Number 1 Region: 147-194,231-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000513
Family Ankyrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014346   Gene: ENSDORG00000015239   Transcript: ENSDORT00000015240
Sequence length 2020
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2568:8703:67262:1 gene:ENSDORG00000015239 transcript:ENSDORT00000015240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKDKIGSYSKTPKLDRNDVGKEMKEKSSMKRKLPFTISPSRNEERDSDTDSDPGHTSENW
GERLISSYRTYSEKEGPEKKKTKKEAGNKKSTPVSILFGYPLSERKQMALLMQMTARDNS
PDSTPNHPSQTTPTQKKTPNSSRQKDKVNKRNERGETPLHMAAIRGDVKQVKELISLGAN
VNVKDFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVKLL
LRHGGDPFQANKHGERPVDVAETEELELLLKREVPLSGDDEIYTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRYDNTESEFLPEGSSVKSFKHKEKNKQQKDFHLEFGEKSNTKIKDDEHS
PTFENSDCTLKKMDKEGKTLKKHKLKHKEKDKDKHKKETEGEKEKYKNKEVKELQRSVEF
DREFWKENFFKSDETEDLFLNMEHESLTLEKKSKLEKNIKEDKSTKEKHTSKERPFKEER
EKYKRESEKPFREEKIKDLKEERENVPTDRETEFGSLGIIMNEETVALHSTEKEIDIEKQ
EKHIKESKEKPDKRFQAKEKEIEKVERKNSEKEKKIKHEHKSEKEKIDFSDCVDRIKEKD
KLFFYQTEKNKEGEKMRNTIKKTDDREKNKEKMDRKHDKEKPEKERHLGEKEKHLMEKKI
KPSDNSEYTKSEKGRNKEKDKEIDKKEKCKDKESANVTNSRYLQEERKTSIIDSGCKAQH
EKSLSFKEKSKDEVKILDGKDKDRDIDRFDRDRKDKIQLNFLKLKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSLKSPRSENEKLGLSSRSVSMVSIASSEDSCHTTVMTPRPLVEYDSDFMLEGSESQM
SFSQSPFLPTVKSPALHEKELDSLAEMPERIKLPYINRLPASHLRSSSVEDVKLVINEGR
PTVEFRRCSMPSVICEHAKQFQTVSEEINQSSLLAVPRDTCPSPKPEVSSAVPERDLSNV
PYIHSSFAASPTGSVNSKYISSDIIKSTAPVGSLTDSPVYLEPSNQVGVIQNKSWETSVD
RLESLNTNDFICPNSSMPDQDSSVEGICNSENKILREHNTDFLSLHQTELSGNTCAQDST
SFIPSQQPCPVPNQSLSDAESASNPMSLSNIANQELSILQQKNAVQTIISVIDTDNDSTR
YVENTFVSADVRKTENSVPVFSESTIQEVSPHFDMANTLPEFPPEKDFNGSEDGSSQLNI
HYTFSKLTYKSSSGQEAEKSTSDAQIISQEKEYKLQSLILTHLSKSDSDLCEMNARMPKG
NLNEQDNLKHCPESEKYLFSIEDEESQHSTLSSLENHSQQLAQPEMHKYGQLIKVELEEN
AEDDKNENQIPQRMTRNRTNTMANQSRQILTSCTLLPEKDNESSPRGRIRLTEEDDPQIH
HPRKRKVSRVPQPVQVSPSLLQAKEKTQQSLAAIVDSLKLDEIEPYSSERANPYFEYLHI
RKKIEEKRKLLCSVIPQAPQYYDEYVTFNGSYLLDGNPLSKICIPTITPPPSLSDPLKEL
FRQQEVVRMKLRLQHSIEREKLIVSNEQEVLRVHYRAARTLANQTLPFSACTVLLDAEVY
NVPLDSQSDDSKTSVRDRFNARQFMSWLQDVDDKFDKLKTCLLMRQQHEAAALNAVQRLE
WQLKLQELDPATYKSISIYEIQEFYVPLVDVNDDFELTPI
Download sequence
Identical sequences ENSDORP00000014346 ENSDORP00000014346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]