SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014372 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014372
Domain Number 1 Region: 382-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-16
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 415-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000597
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014372   Gene: ENSDORG00000015269   Transcript: ENSDORT00000015269
Sequence length 479
Comment pep:novel scaffold:dipOrd1:scaffold_5871:44865:50481:-1 gene:ENSDORG00000015269 transcript:ENSDORT00000015269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNFGASLQQAAEERMEMISERSKESMYSWNKTTEKSDFEAVEALMSMSCSWKSGFKKYL
ENRPVTPASDTSEEESLLPGTPDFHAIPAFCLTPPYSPSDFEPSQVSNLMAPAPPTGHFK
SFSDPAKPTVPVPFKEEQNPVSTPKLPKAQATSVIRHTADAQLCNHQSCPVKAAGILNYQ
DNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNAVADADEKAGVPRYDFSVPSSETVIC
RSQPAPASPQQKSVLVSPPAVPTGGMSPLPVICQMVPLPANNPVVTTVVPSTPPSQPPAV
CPPVVFMGTQVPKGAVMFVVPQTVVPSPKPPVLSPNGTRLSPIAPAPGFPPSAAKVTPQI
DSSRVRSHICSHPGCGKTYFKSSHLKAHMRTHTGEKPFSCSWKGCERRFARSDELSRHRR
THTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPSVPAPNQ
Download sequence
Identical sequences A0A1S3EUB6
ENSDORP00000014372 ENSDORP00000014372 XP_012868006.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]