SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014489 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014489
Domain Number 1 Region: 55-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 107-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000637
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014489   Gene: ENSDORG00000015397   Transcript: ENSDORT00000015397
Sequence length 429
Comment pep:novel scaffold:dipOrd1:scaffold_13537:27616:35432:1 gene:ENSDORG00000015397 transcript:ENSDORT00000015397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCD
VCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNY
ACRRRDALTGHLRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQ
ALAGQQGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLS
DLPYDVNSGGYEKDVELVAHHGLEPGFGGSLAFVGTEHLRPLRLPPTNCISELTPVISSV
YTQMQPLPGRLELPGSREAGEGPDDLGDGGPLLYRARGPLNDPGASPSNGCQDSTDTESN
HEDRVGGVVTLPQVXXFKVQVGILFLGQVMYTIHLRTHVFRGPIEDGIRDHLQKGKLYCH
MVRVEHMGL
Download sequence
Identical sequences ENSDORP00000014489 ENSDORP00000014489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]