SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014490 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014490
Domain Number 1 Region: 631-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000202
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014490
Domain Number - Region: 101-138
Classification Level Classification E-value
Superfamily SET domain 0.000119
Family Histone lysine methyltransferases 0.042
Further Details:      
 
Domain Number - Region: 152-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00419
Family Classic zinc finger, C2H2 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014490   Gene: ENSDORG00000015398   Transcript: ENSDORT00000015396
Sequence length 691
Comment pep:novel scaffold:dipOrd1:scaffold_9717:28183:31921:1 gene:ENSDORG00000015398 transcript:ENSDORT00000015396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIAL
KSTDKRTVPYIFRVDTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRI
AKDEELLVWYGKELTELLLLCPSRSHSKMNGSSPYTCLECSQRFQFEFPYVAHLRFRCPK
RLHSGDLSPPDEQGGGLGTKDHGGGGSSSSRRQQQPQEASLGPKFCKAGPPIHHYPAPSP
ESSTPAANAGGASAKPSTDFHNLARELENSRGGSSSCSPAQSLGSGGGPGHQEAELSPDG
IGAGGGCKGKRKFPEEAAEGGGGPGVVGGRARFAERPLPASKEDLVCTPQQYRASGSYFG
LEENGRLFAPPSPETGEAKRSAFVEVKKAARPGGLQPDDATXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKCNASFRMTSDLVYHMRSHHKKEYAMEPLV
KRRREEKLKCPICNESFRERHHLSRHMTSHN
Download sequence
Identical sequences ENSDORP00000014490 ENSDORP00000014490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]