SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014531 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014531
Domain Number 1 Region: 367-483
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.91e-36
Family Ankyrin repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily RING/U-box 8.72e-34
Family RING finger domain, C3HC4 0.0000308
Further Details:      
 
Domain Number 3 Region: 517-615
Classification Level Classification E-value
Superfamily BRCT domain 1.18e-20
Family BRCT domain 0.0094
Further Details:      
 
Domain Number 4 Region: 617-722
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000571
Family DNA topoisomerase II binding protein 1, TopBP1 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014531   Gene: ENSDORG00000015439   Transcript: ENSDORT00000015439
Sequence length 723
Comment pep:novel scaffold:dipOrd1:scaffold_2380:35481:95423:-1 gene:ENSDORG00000015439 transcript:ENSDORT00000015439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNILTDPVCLGGCEHIFCSDCVSDCIGTRCPVCYTPAWVLDVKINRQLDSMIHLCSKLRN
LLHDNELSDVKEDTSRTRIFNDAENKKNSIKMWFSPRSKRVRYVVNKVSVQTQPKKTTDD
KALPTSMYEFISTTPPTVVSKRARKASSTPAKKQTTRTLAEINQEWNIESEQEGSDFMSK
DESKERIVSFCSQPSILSTPEESDGIDLIESCSVSESECGNVTEVSLPLAEHTVSPDTES
KNVVTSEKVYKNDHTSNTSLTLGCNGKHRSSNRLSQPVPKRSRSRIPSTPKGSVKPTVYS
ANLRLLDCSSSSKLPVDDTLRRRNSNTSDDSISLSPPTLPSSLNSSTYRRMMSSPSTTKL
LPSSLVVGKRNHRGETLLHIASIKGDVPSVEYLLQNGNDPNVKDHAGWTPLHEACNHGHL
KVVELLLQHKALVNSTGYHNDSPLHDAARNGHLDIVKLLLSHGASRSVVNIFGLRPVDCT
DNENMKSLLLLPEKNESSSTCYQSVMSSWSRRDGPLVLIGSGLSSEQQSLLSELAGILKA
KKCAEFDSTVTHVIVPGDQAQSTLKCMLGILNGCWILKFDWVKACLQTKVYEEEEMYEIP
EGPQRSRINKELLLPKLFDGCYFYFWGTFKHHPKDNLTKLVTAGGGQILSRKPKPDSDVT
QTINTVSYHAKPDSDQRFCTQYIVYEDLSDYGPERVRQGKVWMAPSSWLISCVISFELLP
LDS
Download sequence
Identical sequences ENSDORP00000014531 ENSDORP00000014531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]