SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014571 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014571
Domain Number 1 Region: 31-117
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-34
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 615-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.94e-23
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 657-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000213
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 424-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000948
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014571
Domain Number - Region: 383-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00159
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 324-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.025
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014571   Gene: ENSDORG00000015480   Transcript: ENSDORT00000015480
Sequence length 715
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5442:5611:16905:1 gene:ENSDORG00000015480 transcript:ENSDORT00000015480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVVPLNKMTAASPNLPSVALRAVNKAPRMDTFRQKFRWFCYSGEAGPRKTLNQLWELC
TQWLRPDINTKEQILELLVFEQFLSVLPGEMRIWVQSQRPESSEDVVTLMEDLFETLEEK
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIEKIIEKCIEDDAY
IFMAEFQKHHGPDEEDGGEHRHSKETQKKTQRKGAKGDESDPEKSLIGKNPKNSDLIKYQ
RYRKKAQQSNEGKKFSFHSDVLNCKEHTAEKSRKHSENGKGVTHSSSLAEHKKHQKIRLG
EKSQKCSKCGVTFTQSSSSKNSTSTCEKCQKNLRQDTATNKDKRPENGEKSRKCGKCGKC
FGYSALTKRPRNLTGEKPYTCIKCRKAASNSSSRSSGRGSPTDEKLCKCDVCGKSFTVIH
HLMKHQRTHTGEKPYACKDCGRAFSDSSSLSQHQRIHTGEKPYKCSECDKSFSHSSSLTK
HQRIHTGEKPYKCDDCGKTFRQNSCLTRHQRIHTGEKPYVCKDCGMAFTHFTSALYHQRL
HSGEKPYKCDECKKAFSSHSLLSRHMRSHTGVTPYKCKECGKVFRQSSSLNEHFRVHTGE
KPYECDVCGATFHRTSLLVEHVKIHARNRKYPCNKCDKVFKCNNSLVKHRVVHAT
Download sequence
Identical sequences ENSDORP00000014571 ENSDORP00000014571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]