SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014759 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014759
Domain Number 1 Region: 835-912
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000964
Family Homeodomain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014759
Domain Number - Region: 274-298,376-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00111
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Domain Number - Region: 928-951,992-1016
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00125
Family C2HC finger 0.082
Further Details:      
 
Domain Number - Region: 210-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0614
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014759   Gene: ENSDORG00000015686   Transcript: ENSDORT00000015686
Sequence length 1037
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5861:12947:222391:1 gene:ENSDORG00000015686 transcript:ENSDORT00000015686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQQAPKRAAGYVQEEQLKEEEDIKEEEEEEEDSGSVAQLQESNDTGTDEELETGPE
QKGYFSCQNSPESHLSNQDAENESLLSDASDQVSDIKSIRGRDATHKKASAHPKPPSEGH
NCMDKMTAVYANILSDSYWSGLGLGFKVSNSERRNCETRNGNGKSDFDWHQDALSKSLQQ
NLPSRSVSKPSLFSSVQLYRQSSKVCGTVFTGASRFRCRQCSAAYDTLVELTVHMNETGH
YQDDNRKKDKLRPTSYSKPRKRAFQDMDKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKH
YQKVPLKEPVPTISSKMVAPAKKRVFDVNRPCSPDSTTGSFADSFSSQKSVNLPLSSNNR
YGYQNGASYTWQFEACKSQILKCMECGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQL
VLDPLAVEKMQSLSETPSSESLAPKPSSNSMMDCTASTTELKKESKKEKSEESPKEEKVV
KSEVYEDPLQKPLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWS
AYPSIHAAYQLSEGTKPPLSMGPQLLQIRPNLAHKLRPIAPKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRDKPMK
ESEKEKGQPLEPVSSMSSLSNGCVLATHTPALPCINPLSALQSVLNNHLGKATEPLRSPS
CSSPSSSTMSMFHKSNLGVMDKPVLSPAPTRPASVSRRYVFENNDQPIDLTKSKSKKAES
SQAQSCTSPPQKHALCDIADMVKVLPKATTPKPAASSRVPPVKLEMDVRRFEDVSSDVST
LHKRKGRQSNWNPQHLLILQAQFASSLFQTSEGKYLLSDLGPQERMQISKFTGLSMTTIS
HWLANVKYQLRKTGGTKFLKNMDKGHPIFYCSDCASQFRTPSTYITHLESHLGFQMKDMT
RMAADQQSKVEQEISRVSSAQRSPETIAGEEDTDSKFKCKLCCRTFVSKHAVKLHLSKTH
SKSPEHHSQFVTDVDEE
Download sequence
Identical sequences ENSDORP00000014759 ENSDORP00000014759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]