SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014770 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014770
Domain Number 1 Region: 48-167
Classification Level Classification E-value
Superfamily POZ domain 1.47e-27
Family BTB/POZ domain 0.0008
Further Details:      
 
Domain Number 2 Region: 470-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000175
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014770   Gene: ENSDORG00000015697   Transcript: ENSDORT00000015697
Sequence length 572
Comment pep:novel scaffold:dipOrd1:scaffold_7718:53943:56003:1 gene:ENSDORG00000015697 transcript:ENSDORT00000015697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLREFSEWGVVASSGKAWERVLVGKSRRYRGATGGDISWAPFPSWGAMEFPEHSQQLLQS
LREQRSQGFLCDCTVMVGSTQFLAHRAVLASCSPFFQLFYKERELDKRDLVCIHNEIVTA
PAFGLLLDFMYAGQLALRGDTPLEDVLAAASYLHMNDIVKVCKQRLQARALAEADSTKKE
EETNSQPLSLEFLSSTSRGSQHSLASAEPSGHWGKEEWKSPAPLPVVRPTDEPPMPGGAD
TTQPSMEVDSPHLRALPPVTDVSVSLASPSSSTETISANYFSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLLPGPGQYHRGLVTSPLPAPPALHEPLYPPSEYEAAPGTFGVFTDDVPTCKTCGKTFSC
SYTLRRHATVHTRERPYECRYCLRSYTQSGDLYRHIRKAHNEDLAKRSKPDPEAGSVLGM
QPLSGSPTADRQGTGGGGPPKDFVLAPKINNW
Download sequence
Identical sequences ENSDORP00000014770 ENSDORP00000014770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]