SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014790 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014790
Domain Number 1 Region: 253-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-17
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 314-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000412
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 223-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000451
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 363-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000103
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014790   Gene: ENSDORG00000015720   Transcript: ENSDORT00000015720
Sequence length 573
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1744:14920:27188:-1 gene:ENSDORG00000015720 transcript:ENSDORT00000015720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVS
LPSGIGMDGEAKSEQLTPHSQAPATQNITVVPVPSTGLMAAGVSCSQRWXXXXXXXXGPG
LVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPELSKKAGSTLPEEGGGGG
GGGGGVAPKAPRGRKKKRMLESGLPEMSDPYVLAPEDDGHQKDGKTYRCRMCSLTFYSKS
EMQIHSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNFCEKAFRQLSHLQQ
HTRIHSKMHTETIKPHKCPHCSKTFANTSDLAQLRIHSGAKPYNCSYCQKARQLLYQQHT
RIHTGDRPYKCAHPGCEKAFTQLSNLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKDICLTVTTSTIQVEHLASS
Download sequence
Identical sequences ENSDORP00000014790 ENSDORP00000014790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]