SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014840 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014840
Domain Number 1 Region: 15-107
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.14e-32
Family SCAN domain 0.00021
Further Details:      
 
Domain Number 2 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.87e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 338-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000313
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 435-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000683
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 299-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000105
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014840   Gene: ENSDORG00000015774   Transcript: ENSDORT00000015774
Sequence length 492
Comment pep:novel scaffold:dipOrd1:scaffold_20274:5439:9064:-1 gene:ENSDORG00000015774 transcript:ENSDORT00000015774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILAPLDTQGSVLLEYETNTEISRQLFRQFQYTAAAGPREAFTKLWELCCEWLKPKMRSVE
QILEMLVLEQFLSILPSNIETWVRAHGPENQERLFSLIEDLQNQHGNRDYKINIGDMLLK
EQSVLESEFIPANRCIEQPVFQIVEYVQDPPLTEAKKQQAEPQEPNCSAAGESQTIVNPA
PATQKPDWSLPLEKGGQLWIENLTLTGFDLGRGNEKKSKQRSRVVCVCVCVVSVDGNFCQ
GPSSSKQCGQLDLLCEEPTEDIRTAWESSVELPRPCLGKSVQKERFVSKRVPKQKVLREK
PYHCSQCGRCFVHATELANHLIIHEDLFYVCNTCGKGFIHKSELCEHKFIHIKERPYECS
VCNERFTQQEQLTMHQKRHLERKHYQCSECHRTFLHRSSFSEHKKTHTGEKSHRCLTCGR
TFLRRATLTRHQVTHTTEKPFPCELCEKRYRHKSSLRLHKKTHMGNIPFKCSCCPKKFLK
KYDLVLHLAAHL
Download sequence
Identical sequences ENSDORP00000014840 ENSDORP00000014840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]