SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014871 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000014871
Domain Number - Region: 7-33
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00393
Family CHHC finger 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014871   Gene: ENSDORG00000015808   Transcript: ENSDORT00000015808
Sequence length 432
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2317:1476:12702:1 gene:ENSDORG00000015808 transcript:ENSDORT00000015808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EENSRKRILCPLDPKHTVYEDQLAKHLKKCNAREKPKPDFFIQDINAGLKDDTEILEQLV
PISSLSEEQLGNLINKLRKASEGLSSTLNDHIMSHPALHDAINDPRNGDSATKHLKQQAS
ILGNIEKLQLLGPRRCFVEFGAGKGKLSHWVDVALKDAEKVHFILVEKVTTRFKVDGKHR
KKNSVFERLQIDIQHLCLNKIPVLREGKLPVVGIGKHLCGVATDLALRCLVETYAACYEK
RNEEPLAKRIKNDKTENEINTLAKEGSENNVPEKWTPVAGIVIALCCHHRCEWRHYVGKE
YFRGLGLGAVEFHYFQRMSSWATCGMRKAPLEDTAITTKSKDHQSDDSEEHDDGEYRITD
DSTDNLPGILTVEEKKKIGHLCKLLIDQGRVQYLQHKGFSPALQNYIDPLVSLENVLLTA
LPIPSSSLQTTG
Download sequence
Identical sequences ENSDORP00000014871 ENSDORP00000014871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]