SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014908 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014908
Domain Number 1 Region: 45-205
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.79e-16
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014908   Gene: ENSDORG00000015847   Transcript: ENSDORT00000015848
Sequence length 849
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3254:3389:43421:-1 gene:ENSDORG00000015847 transcript:ENSDORT00000015848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMEGSPSLRRTTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKML
EESRTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVE
AILSHPAFAASGRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHML
LLKGARIERPHDYFCKCAECAEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTAL
ELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESTEPLDM
HRHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALG
LPFLAMGYWIAPCSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXMMWSECKELWLEGPREYILQLWNVLDFGMLSI
FIAAFTARFLAFLQATKAQQYVDSYIQESDLSEVTLPPEIQYFTYXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMV
VVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYF
IMRIMNFSKCRRRRLQKDLEMGMGNSKSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIM
KRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEK
LNPGMLRCE
Download sequence
Identical sequences ENSDORP00000014908 ENSDORP00000014908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]