SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014933 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014933
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.7e-35
Family SCAN domain 0.0000447
Further Details:      
 
Domain Number 2 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 410-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 261-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000752
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 458-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000766
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014933   Gene: ENSDORG00000015875   Transcript: ENSDORT00000015874
Sequence length 484
Comment pep:novel scaffold:dipOrd1:scaffold_77487:2843:4607:1 gene:ENSDORG00000015875 transcript:ENSDORT00000015874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSLSPVPWEYNSFQVKVEEEEEADLSQGQEFSPCSATLEAARLRFRHLHYEEASGPHAAL
IQLRELCHQWLQPELCTKEQMLELLVLEQFLGSLPAKIQAWVVAQCPKSGEEAAMLVENL
TKMLHKRGWELGAESAEANCKQSNSEELGSPDNTTETLMRGVSPGPAFVNACEPEDSLQS
GTELLRAIWTKSAPQELAFRKTKPSKDTPPDQPGSECGAPRPSTNMWPALPSQEKTPSAE
KLGLSDGYRKVPSYTYSEKKLSRCGECRKTFQNTLALTAHQKSHSRKTPYACSECGKAFS
RSTHLVQHQVVHTGAKPHVCEECGKAFSRATHLAQHQRTHTGEKPYQCGACGKSFSRSTH
LTQHQRVHTGERPYECEECGKTFSQSTHLTQHQRVHTGEKPYRCDACGRAFSDGSALIRH
LRIHSGEKPYQCKVCAKAFAQSSSLIEHRRVHTGEKPYKCSDCGKAFSRSSALTVHLRVH
ITVL
Download sequence
Identical sequences ENSDORP00000014933 ENSDORP00000014933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]