SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014944 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014944
Domain Number 1 Region: 3095-3253
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-41
Family C-type lectin domain 0.00000556
Further Details:      
 
Domain Number 2 Region: 147-256
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-40
Family Link domain 0.0025
Further Details:      
 
Domain Number 3 Region: 250-356
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-31
Family Link domain 0.0029
Further Details:      
 
Domain Number 4 Region: 3051-3092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000625
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 5 Region: 3254-3312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000876
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014944   Gene: ENSDORG00000015885   Transcript: ENSDORT00000015885
Sequence length 3356
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5519:269726:358077:1 gene:ENSDORG00000015885 transcript:ENSDORT00000015885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINIKSLLWMYSILIVTHVLHKVKAEKSPVKGSLAGRVSLPCFSTMXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVVFHYRAATSRYTLNFETAKKACLDIGAVIASP
DQLFAAYEDGFEQCDAGWLSDRSVRYPIRAPREGCYGDMMGKEGVRTYGFRSPQETYDVY
CYVDHLDGDVFHITIPNKFTFEEAAEACEDQDARLATVGELQAAWRNGYDQCDYGWLLDA
SVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKQNISEATTTEMNI
LIETAAASLSKEPQMVLDRTTPIIPFTTKLPIITATFPPAGNIVNFEQKSTVQSQAVTDR
LVTKSPTPAWDMKKPWDMDNSLASVSRQPEKPDTSDIEGEVLRSTTNIFHHATDAWDAVT
EDTQTQDSVTQAEQIEVGPLTSIENSKYIPSKELSITETPLVTEKKTISMTPELVTTSDY
GFALGEDDSEDITLTSRSGQSTWVFSQIPEVITVSKSSEDTTPSQLEDLESMLASTVVSP
VTVPDKYGSSTDSGEEKQTNGKATKEFFDKFLSTTPFEPHLTEVDLFPYSGDSMLVEGTP
TAIHPSPQAEITQGKEITTAPRPEGRTDTYTDDGMQEKVTKDSLTHKPEEEDFSGMKVST
PSFEQVDFTEPSPTLTTVKLRAMPTEARDVEEVTTAHRLEADDFQDTIKYDEDITTAHLT
RSTFVEVVTVSKWSWEETNATSKPLDATEDAGAPKIPPIFLTTIGVNGKDEEAPSFTEEG
RDQVAFIPDSTPSTLEKLTEKDFTLGKFTVQDQPTPSVGTAEMSTLRQSTTEGRVLPATS
TEGQVVHVTLEESGLGEGEDIDASKPLFTLPPITHISEAEDLAFVNDSSTQEPTPYVATS
HTIPFSVIPKTEWGVPSVTSEGEVLGEPSQDIQVIDQTHLEATMSSETLRTTTEITQATS
QDEFIWNEQTTRKPVPPLSSTASRPREATPFDEEEGNGSAYTVFEDSLVTDSDRISVLEP
TSVGKIEDGLAYSPGAITEHKAETDEMVTLTSSIKPKVVVSPEAEGSSSTEFVSPLSPFS
THVTELVRETTTEEGEKTSLDDIEAGSGLFEKPQTTELTSDIIATFGSIDRLHPTSALEL
PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMSDLSVMGH
PIDSESKEDEPCSEETDPVHDLIAEILTELPSVIDIDIYHSEENEEEDDDCTNGTEVTTT
PSVQYINGKQLVTTVPRDPEAAEARRGQFESVAPSQNFSDSSESDSQRYEMTETELSNRG
QPNESQETTEFLEMTWKPETYPESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVETSFSSKPTGL
ALSTVMNREATEIINQTSKEKLMAEVAGAPTPRAEMRDFSTGSPGEEGFSGDFGDYSTVS
YPITSDRTMMEGSGYASITNDQISPSVIPTSDHSHVLSNSEQPSSTMVSTSAFPWEEFAA
SAEGSGEQLVPGRSSANPVSPTDAENLSDTDSSLLDQGLEEMSVMNETDKRVTILPTVEA
ESTADSSEKGEVKADGRIAVDFLQTIEPSTLWSTPEVSSISQAIQSTTVSDRTIQEQRPF
EFFQSSLVSEHTTFGTQIYPELQTTDDSILTMKKTFSNDKEMEEESMSLLHMSTPYSDPK
GLESYTPLPETTERPDSSLAPVLVTELLPTENVRTDSSINKDGRIELIPENMRPILKESD
TDLLFSGLGSGEEVLPPLPTMSVNFTKMEQIISTSYPHMVSLATSISSGNMEDYERIGSV
ANEIRTFISKTDNISEGTEAVSDTTLIEILSDIGAEGHTTAPLPLSRDIDHPQNQTIKWE
EEIQTSQPQTRIEQTSSKNSSTSETEETSTSSAVFLPRTYGLEMAKEFVMSIPMPTDMSH
ENSGEGSGEMNSFDLFHTSKTTEATKQGSTPFVSDGFLEKHPEAPRAEAGKADVYATISA
MLPLHPEANETSPNLVSMLPTTVPHERPTEGRAGSFQDHLEALKDSTSKPNRRKSSENII
IDLDKEDMDLILTVTESSILEILPELTSDKNTIIDIDHTKPIYTDILGMQTDIDPDIPSG
PHGSNEENSQVQEKVTADNLSLTKESSEGFGDTLLASNTQPTYSESMTLEDRNLLDHRGF
DSAAGTPVPTRETDVDILLPTASSLPIPRKSTTTNPEIKELESKAIPLDDIFESSTLSDG
QAIADQSEIISTMGHLERTQENFEEKKHTDSSFQPEYSSGDEEALIDSTSYVSITSIHHT
APSLTEASHGLGVSSPSYYTDTASAVSAFMRLPSQVPPSPFPVYVGSRASEHPEILEPSA
PPATEAGSSQRPPNDSFKEAHTKSEVTVKPSSEEDVHRTETPFVSPDTELSEDKPRLSEV
TESTAEEETESSHDSTSKSNYLLSGESIEVFLSSRTPEAETITTAASENKLEDATQWPHF
SSASATFRASLVPTPHPQTSERPTTPPSLERYPETHAVLMRGQGSTVAASEKQVELRILD
SSNQATISTVDSNTELATSPFSLLDTKETDFLIGINEESVEGTAVYLPGPDRCKTNPCLN
GGTCYPTETSYVCTCVPGFSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGA
LCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQVFVNRLG
HDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVP
CNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCL
GNGRWAMPKITCMNPSAYQRTYSKKYLKNSSSAQDNSINTTKHDHRWSRRWQESRR
Download sequence
Identical sequences ENSDORP00000014944 ENSDORP00000014944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]