SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014950 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014950
Domain Number 1 Region: 61-245
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-43
Family Ankyrin repeat 0.00064
Further Details:      
 
Domain Number 2 Region: 318-455
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.76e-19
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 542-584
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000116
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014950   Gene: ENSDORG00000015891   Transcript: ENSDORT00000015891
Sequence length 586
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3344:23393:45208:-1 gene:ENSDORG00000015891 transcript:ENSDORT00000015891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCFSYADYFSLFHSCSVPSRSAVPPEPPPARAPMGLFQGVMQKYNSSLFKSSQLAAMDP
VLKAIKEGNEEALKVMIKDGKNLAEPNKEGWLPLHEAAYYGQLGCLKVLQQAYPGAIDQR
TLQEETALYLATCREHLDCLLSLLQAGAEPDISNKSRETPLYKACERKNAAAVRILVQHN
ADANHRCNRGWTALHESVSRNDLEVMEILVGGGAKVEAKNAYGITPLFVAAQSGQLEALR
FLAKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXIVQMLLPVTSRTRVRRSGVSPLHLAAERNHDAVLEALLGARFDVNAPLAPERARLYE
DRRSSALYFAVVNNNVRATELLLGAGADPNRDVISPLLVAIRHGCLRTMRLLLDHGADID
AYVATHPTAFPATIMFAMKCLSLLKFLMDLGCDGEACFSCRYGNGPHPPAPPRAGRFHDA
PAEDKAPGAVQFCEFLSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKE
AEPPRPLAHLCRLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ
Download sequence
Identical sequences ENSDORP00000014950 ENSDORP00000014950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]