SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014957 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014957
Domain Number 1 Region: 74-200
Classification Level Classification E-value
Superfamily Lysozyme-like 2.43e-47
Family C-type lysozyme 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014957   Gene: ENSDORG00000015899   Transcript: ENSDORT00000015898
Sequence length 202
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3417:285:4782:1 gene:ENSDORG00000015899 transcript:ENSDORT00000015898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQDSFPSSSEVLCVSGPPGLFVNSAWSQSGGGCTCGTHMETRSPAPRKQLCPSGIAVLAF
LSLLSCLLPSSEAKVYSRCELARVLQNFGLDGFRGYDLADWVCLAYFTSGFNTAAVDHEA
DGSTNNGLFQISSRRWCKNLTPNAINICRMYCTDLLNPNLKDTVICAMKIAQEPQGLGYW
EAWRHHCQGKDLRDWVDGCDFM
Download sequence
Identical sequences ENSDORP00000014957 ENSDORP00000014957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]