SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014971 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014971
Domain Number 1 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.97e-28
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 192-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.78e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 293-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 28-87
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000811
Family KRAB domain (Kruppel-associated box) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014971   Gene: ENSDORG00000015914   Transcript: ENSDORT00000015914
Sequence length 369
Comment pep:novel scaffold:dipOrd1:scaffold_30200:11654:16737:-1 gene:ENSDORG00000015914 transcript:ENSDORT00000015914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPATHVPAPHPQGSPRDQAVASALLTADSQAMVKIEDMAVSLILEEWGCQKLARRTLSRD
SRQENCGKVFSQGCENRTDNEESTYKSEVTENSMVQGDTVGRPQKEFGEKREHQGRVVER
QQRNPEDKTGKEKRESGLATAKEKKASVGERGPREKGKALGRSFSLSSNFQTPEDVPPGA
KAHRCDECGKCFTRSSSLIRHKIIHTGEKPYECGECGKAFSLNSNLVLHQRIHTGEKPHE
CHECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYECSEC
GKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERASEYSPASLDA
FGAFLKSCV
Download sequence
Identical sequences ENSDORP00000014971 ENSDORP00000014971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]