SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015010 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015010
Domain Number 1 Region: 49-153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 2 Region: 211-285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000209
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 3 Region: 289-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015010   Gene: ENSDORG00000015955   Transcript: ENSDORT00000015955
Sequence length 531
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4950:13601:69335:-1 gene:ENSDORG00000015955 transcript:ENSDORT00000015955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYGRRVLLIVASLIILHLSGATKKGTEKQTTEEIQKSGQCETWTKHAEGVFNSPKYPSK
YPPERECVYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQQ
NPPVIKSSGRFLWVKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPVCFDMCGSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYLRFLDYEMQNSNECKRNFVAVYDGSSS
VEDLRAKFCSTVANDVMLRTGLGVVRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCHSN
MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIISVI
VQIKQPRKKYVQRKSDFEQTVFQEVFEPPHYELCTLRGTGATADFADGADDFDSYHKLRR
SSSKCIHDHHCGSQLSSAKGSRSNLSTRDAPILTEMPTQPAKPLLPPVNRRNILVMKHNY
SQDPADACDVDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences ENSDORP00000015010 ENSDORP00000015010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]