SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015142 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015142
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 287-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 189-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000765
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015142   Gene: ENSDORG00000016099   Transcript: ENSDORT00000016099
Sequence length 543
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4463:5042:14112:1 gene:ENSDORG00000016099 transcript:ENSDORT00000016099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLQGPVSFKDITVDFTAEEWQQLDHAQKALYRDVMLENYCHFISVGFHITKPDMIRKLE
QGGELWTQRIFPSQYGEDENAEDVLVELKKYQDKHSRSIVFINHKKIIKERNIYGKGLCL
SKNHITSKALCDYKPDRKFLKNISEFIRNLNPVREKLGESNGWEKSVLSTKHEKVHRTVN
LHKSTEKDFSGKQEIAQHQKVRTAEPPFECNECNKSFFMKRMLFAHIRVHQGERTSEYNK
DGIAFLEKSDLSGHLHHLIEKKSSPYNKLLCRKSGFLVQQRSQTEDKPFQCPYCGNSFRR
KSYLIEHQRIHTGEKPYVCNQCEKAFRQKTALTLHEKTHIEGKPYVCIDCGKSFRQKATL
TRHHKTHTGEKAYECSQCRSAFRKKSYLVDHQRTHTREKPYQCNECGKTFIQKTTLTVHQ
RTHTREKPYICNDCRKSFCQKTTLTLHQRIHTGEKPYICNECGKSFRQKAILTVHHRIHT
GEKSNGCTQCGKAFSRKSNLIRHQKTHTGEKPYECKECGKFFSCKSNLIVHQKTHKVQSV
RIQ
Download sequence
Identical sequences ENSDORP00000015142 ENSDORP00000015142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]