SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015176 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000015176
Domain Number - Region: 76-123
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0229
Family SPRY domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015176   Gene: ENSDORG00000016135   Transcript: ENSDORT00000016135
Sequence length 196
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2360:9303:23351:-1 gene:ENSDORG00000016135 transcript:ENSDORT00000016135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVFCCLRCCRDGGTGHIPLKEMPAVQLDTQHMXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVYXXXXXXXXXXFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences ENSDORP00000015176 ENSDORP00000015176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]