SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015202 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015202
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.55e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015202   Gene: ENSDORG00000016161   Transcript: ENSDORT00000016161
Sequence length 380
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_775:2563:33979:1 gene:ENSDORG00000016161 transcript:ENSDORT00000016161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPXXXXXXXXXXXX
XXXXXXXXXXXXXXKEKDDKWKRGTEAAPEKKMEPVVFEKVKMPQKKEDPQLPRKSSPKS
TAPVMDLLGLDAPVACSITNSKTSNNLEKDLDLLASVSSPSSVSRKVVGSMPTAGSAGSV
PENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQIPAQAMFMAPAQMAYPTAYPSFP
GVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPGGYMGGMQASMMGVPNGMMTTQQAG
YMAGMAAMPQTMYGVQPAQQ
Download sequence
Identical sequences ENSDORP00000015202 ENSDORP00000015202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]