SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015208 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015208
Domain Number 1 Region: 2571-2641
Classification Level Classification E-value
Superfamily Homeodomain-like 1.28e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 2 Region: 2979-3023
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000567
Family HkH motif-containing C2H2 finger 0.00041
Further Details:      
 
Domain Number 3 Region: 2894-2962
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000158
Family Homeodomain 0.0061
Further Details:      
 
Domain Number 4 Region: 1402-1449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000905
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number 5 Region: 693-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000626
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 744-803
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000223
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 2472-2494,2649-2676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000236
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number 8 Region: 1526-1579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000925
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015208
Domain Number - Region: 3403-3452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000941
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 1045-1089
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00306
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 1222-1246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00351
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 933-978
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0101
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 619-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0205
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number - Region: 1942-1971
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0663
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015208   Gene: ENSDORG00000016167   Transcript: ENSDORT00000016167
Sequence length 3591
Comment pep:novel scaffold:dipOrd1:scaffold_137:80513:251275:1 gene:ENSDORG00000016167 transcript:ENSDORT00000016167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METCDSPPISRQENGQSTSKLCGTPQLDNEVPERVAGMEPDRENSSRDDNLKTDERKSEV
LLGFSVENAAATQVTSAKEIPCNECATSFPSLQKYMEHHCPNARLPVLKDDNESEISELE
DSDVENITGEIVYQPDGSAYIIEDSKESGQNAQTGANSKLFSTAMFLDSLASAGEKSDQS
ASAPMSFYPQIINTFHIASSLGKPFTADQAFPNTSALAGVGPVLHSFRVYDLRHKREKDY
LTSDGSAKNSCVSKDVPSNVDLSKFDGCVSDGKRKPVLMCFLCKLSFGYIRSFVTHAVHD
HRMTLNDEEQKLLSNKCVSAIIQGIGKDKEPLISFLEPKKSTSVYPHFSTTNLIGPDPTF
RGLWSAFHVENGDSVPAGFAFLKGSSSPTSSSAEQPLGITQMPKAEVNLGGLSSLVVNTP
ITSVSLSHSSSESSKMSESKDQENNCERPKESNVLHPNGECPVKSEPTEAGDEEEDDAYS
HELDDEEVLGELTDSIASKDFSLLNQSISPLSSSVLKFIEKGTLSSSAAATMADDPEKKK
QPTALRASGSGVAANYSTGGKDFADPSASKDSATAAQPSDTAARGDEDSSAAPHQHGFTP
STPGTPGPGGDGSPGSGIECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKY
QQTLEAHMKEKHPEPGGSCVYCKTGQPHPRLARGESYTCGYKPFRCEVCNYSTTTKGNLS
IHMQSDKHLNNVQNLQNGNSEQVFGHSTPAPNTSLSGCGTPSPSKPKQKPTWRCEVCDYE
TNVARNLRIHMTSEKHMHNMMLLQQNMKQIQHNLHLGLAPAEAELYQYYLAQNIGLTGMK
LENPADPQLMINPFQLDPATAAALAPGLVNNELPPEIRLASGQLMGDDLSLLTAGELSPY
ISDPALKLFQCAVCNKFTSDSLEALSVHVSSERSLPEEEWRAVIGDIYQCKLCNYNTQLK
ANFQLHCKTDKHMQKYQLVAHIKEGGKSNEWRLKCIAIGNPVHLKCNACDYYTNSVDKLR
LHTTNHRHEAALKLYKHLQKQESAVNPESCYYYCAVCDYSTKVKLNLVQHVRSVKHQQTE
GLRKLQLHQQGLPPEEDNLSEIFFVKDCPPNELETASLGARTCEDELTEQQLRTTSEEQS
EETEGATKPMAVAEDEEKDPNEKDNSEGKNSSKDSGIITPEKELKVSVAGGTQPLLLAKE
EDVATKRSKPTEDNKFCHEQFYQCPYCNYNSRDQSRIQMHVLSQHSVQPVICCPLCQDVL
SNKMHLQLHLTHLHSVSPDCVEKLLMTVPVPDVMMPNSMLLPAAASEKSERDTPAAVTAE
ASGKYSGESPMDDKSMAGLEDSKASVEIKSEEQKPAKEPTELSEWNKTSSKEVKIPDTLQ
DQLTEQPKRQPLSVSDRHVYKYRCNHCSLAFKTMQKLQIHSQYHAIRAATMCNLCQRSFR
TFQALKKHLEAGHPELSEAELQQLYASLPVNGELWAENEGMVQDDHGLEQDMEREYEVDH
EGKASPVGSDSSSIPDELGSEPKRTLPFRKGPNFTMEKFLDPSRPYKCTVCKESFTQKNI
LLVHYNSVSHLHKLKKVLQEASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXQSPAQIQMQLQHELQQQAAQPQLNPAFLHFPMTPEALQFQQQFLFPF
YIPGTEFSLGPDLGLPGSATFGMPGMTGMAGSLLEDLKQQIQTQHHVGQTQLQILQQQAQ
QYQATQPQLQPQKQQQQQQQQQQQQTSKLLKQEQSNLASNDCQVMKDMPSYKEAEEVAEK
QEKPKQELTNEGEGLKEGKDTKKQKSSEPSIPPPRIASGARGNAAKALLENFGFELVIQY
NENRQKVQKKGKSGEGENTDKLECGTCGKLFSNVLILKSHQEHVHGQFFPYGALEKFARQ
YREAYDKLYPISPSSPETPPPPPPPPPSQPAPPQPTSMGPVKIPNTVSTPLQAQPIPSTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEKTSPKPDYPTEKPKQSDPSPP
PQGTKPALQSTSTSSDPPQTSTAQSQPQPQPLKQPQLIGRPPSTSQTPVPSSPLQITMTS
LQNSLPPQLLQYQCDQCTVAFPTLELWQEHQHMHFLAAQNQFLHSPFLERPMDMPYMIFD
PNNPLMTGQLLSSSLTQMPPQTASSHTGAPATVAASLKRKLDEKEDNNCSEKEGGNSGED
QHRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAREVGLKKRVVQVWFQNTRARER
KGQFRAVGPAQSHKRCPFCRALFKAKSALESHIRSHWNESKQAGYSLPPSPLIATEDGGE
SPQKYIYFDYPSLPLTKIDLSSENELASTVSTPVSKTAELSPKNLLSPSSFKAECPEDVE
NLNAPPAEAGYDQNKTDFDETSSINTAISDATTGDEGNAEMESTTGSSGEVKPALSPKDP
KGLDVLPKPATTPTPEVCDDKFLFSLTSPSIPFNDKDGDHDQSFYITDDPDDNADRSETS
SIADPSSPNPFGSGNPFKSKSNDRPGHKRFRTQMSNLLKVLACFSDYRTPTMQECEMLGN
EIGLPKRVVQVWFQNARAKEKKFKINIGKPFMINQSGTEGTKPECTLCGVKYSARLSIRD
HIFSKQHISKVRETVGSQLDREKDYLAPTTVRQLMAQQELDRIKKASDVLGLTVQQPGMM
DSSSLHGISLPASYPGLPGLPPVLLPGMNGPSSLPGFPQNSNTLTPPGAGMLGFPTSATP
SPALSLSSAPTKPLLQTPPPPPPPPPPPSSSLSGQQTEQQNKESEKKQMKPNKVKKIKEE
ELEATKPEKHPKKEEKISSALSMLGKVVGETHVDPTQLQALQNAIAGDPASFLGGQFLPY
FIPGFASYFTPQLPGTVQGGYLPPVCGMESLFPYGPAVPQTLAGLSPGALLQQYQQYQQN
LQDSLQKQQKQQQEQQQKPVPAKTSKVDSDQPQNSNETSETKEEKSTAPESTKEEPQLES
KSADFSDTYVVPFIKYEFICRKCQMMFTDEDAAVNHQKSFCYFGQPLIDPQETVLRVPVS
KYQCLACDVAISGNEALSQHLQSSLHKEKTIKQAMRNAKEHVRLLPHSVCPPNPNTTSTS
RSAASSSNTYPHLSCFSMKSWPNILFQASARRAASSPSSPPSLSLPSTVTSSLCSTSGVQ
TSLPTESCSDESDSELSQKLEDLDNSLEVKAKPASGLDGNFNSIRMDMFSV
Download sequence
Identical sequences ENSDORP00000015208 ENSDORP00000015208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]