SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015309 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015309
Domain Number 1 Region: 32-317
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.67e-42
Family Ankyrin repeat 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015309   Gene: ENSDORG00000016272   Transcript: ENSDORT00000016272
Sequence length 415
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2321:40896:48161:1 gene:ENSDORG00000016272 transcript:ENSDORT00000016272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNITKRGSRSLVVDRAKSLEDNPVIALHTKLYEAIIKEDCPTIMALLRHHPVNQPLTIL
SNSTSYRLLLSQQTQSIIPIHLATEYHKPQSLLCLLKHGADPEIRAAGLTTLHLMLLHWP
VTSITWAKPCLRVHRILTDIQNNAVKCLRILCEHGAQVNARVDNDNKDSPLHLAITYGTY
PILSILAQSGAQVNATNESSMTPLHMAAEILNKDMIETLIVCGANVNCAVPSTGNTALKL
AVRTASSKAGQLLAAGVGCIRLLLTHGANVNVQDHEGKTALHQACFGGREAIINLLLEFE
ANVNILTRNGESPVYVYLQRSANLRDMTLLTRLLGRTYPLRLTNKQGVLPTGITLPEFQL
LKETLITLSQKPLSLEDICKRQVRNIYGEKYKHHLKQLLPQKIWNSVYYCYDLCT
Download sequence
Identical sequences ENSDORP00000015309 ENSDORP00000015309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]