SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015311 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015311
Domain Number 1 Region: 168-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 112-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 74-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 210-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015311   Gene: ENSDORG00000016274   Transcript: ENSDORT00000016274
Sequence length 272
Comment pep:novel scaffold:dipOrd1:scaffold_60970:1692:4038:-1 gene:ENSDORG00000016274 transcript:ENSDORT00000016274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGFPTATLLDCHGRYAQNVAFFNVMTEAHKYEHSEATGSSSWDFPSSFRREKLEPKSQD
SKSLQEDSPGVRQKVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLV
THQRIHTGEKPYQCQECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRR
VHSGEKPYRCEQCGKAFSQKGSLIVHIRVHTGLKPYACPQCRKSFHTRGNCVLHGKVHTG
ETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL
Download sequence
Identical sequences ENSDORP00000015311 ENSDORP00000015311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]