SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015575 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015575
Domain Number 1 Region: 65-148
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.35e-34
Family SCAN domain 0.00011
Further Details:      
 
Domain Number 2 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 296-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000703
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015575   Gene: ENSDORG00000016555   Transcript: ENSDORT00000016555
Sequence length 439
Comment pep:novel scaffold:dipOrd1:scaffold_33757:4666:13508:-1 gene:ENSDORG00000016555 transcript:ENSDORT00000016555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVPSKDSSWCELSAELDYAKMDMSSAAANTLVFQGTQEQEKIVMLEPNEDQSWEYETRL
PGNPSTSQEVFRQRFRQLCYQEPPGPGEALSQLWVLCCDWLRPERHTKEQILELLVLEQF
LAILPEDLQSWVQEHHPKSGEAVTALEDLKKGLEPGRQVHEPIRKAPLEKEETQLKCETQ
ETPTIQRKCESQEPEPSLKSEQVYCSFPSVVTVDGPEPKEAGLLPQPPVTKVESQVLSEI
LATDISTVKVTWEIETTLKQQQRSTRAERPKRSSAQRESSRLMVVTPKKTLMGNKDYEGS
KCGEAFIYSSLLAVYQRIQSGEKPFQCSDCGKTFHHRSNFIQHQRIHTGEKPYKCKECGK
AFRLGTHLVKHWRTHSGEKPYRCGECGKAFSQSWYLSQHLNVHSGEKPFRYRECGKAYQW
NSMLLRHRRVHASREFPQC
Download sequence
Identical sequences ENSDORP00000015575 ENSDORP00000015575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]